PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0494s0027.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family G2-like
Protein Properties Length: 305aa    MW: 33112.5 Da    PI: 7.1517
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0494s0027.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like108.34.1e-344094155
              G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                         kprlrWt eLH+rFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQkYRl
  Kalax.0494s0027.2.p 40 KPRLRWTAELHDRFVDAVAQLGGPDKATPKTIMRTMGVKGLTLYHLKSHLQKYRL 94
                         79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.2E-333795IPR009057Homeodomain-like
PROSITE profilePS5129412.9263797IPR017930Myb domain
SuperFamilySSF466894.12E-174095IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-244095IPR006447Myb domain, plants
PfamPF002494.1E-94293IPR001005SANT/Myb domain
PfamPF143792.1E-26137183IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010628Biological Processpositive regulation of gene expression
GO:0016036Biological Processcellular response to phosphate starvation
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MYSAIHSIPL DGSSEYHQIS SLDGTNLPGD ACLVMTSDPK PRLRWTAELH DRFVDAVAQL  60
GGPDKATPKT IMRTMGVKGL TLYHLKSHLQ KYRLGKQAGK ESTENSKEAS CMAENQDTGS  120
SASPSSRVIA QEINDYQVTE ALRVQMEVQR RLHEQLEVQR RLQLRIEAQG KYLQAILEKA  180
CKALNDQAVA AAGLEAAREE LSELAIKVSH DTQELAPLDN IKMPSLSDIT AAFESNSKPV  240
PNFPARLGDC SIDSCLTSTG SPSSPVGLSA QNAAMKKRPR PVFGSCESFP FKNMQGVGWM  300
PNSG*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1276280KRPRP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00378DAPTransfer from AT3G24120Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002300173.21e-166myb family transcription factor family protein
SwissprotQ9SAK53e-67APL_ARATH; Myb family transcription factor APL
TrEMBLB9GFX51e-166B9GFX5_POPTR; Myb family transcription factor family protein
STRINGVIT_05s0029g00060.t011e-145(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.11e-117G2-like family protein